PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_3160E1F30.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 62aa    MW: 7274.21 Da    PI: 9.7624
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_3160E1F30.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.31.6e-33257358
                           -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                   WRKY  3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58
                           Dgy+WrKYGqK +k++++prsYY+Ctsa+C++kk+ve+s++dp+++++tYeg+H h
  Traes_3AL_3160E1F30.1  2 DGYRWRKYGQKFIKNNPHPRSYYKCTSARCSAKKHVEKSTDDPEMLIVTYEGSHLH 57
                           9*****************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081128.403160IPR003657WRKY domain
SMARTSM007742.2E-34259IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-31258IPR003657WRKY domain
PfamPF031062.5E-28257IPR003657WRKY domain
SuperFamilySSF1182901.23E-27259IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MDGYRWRKYG QKFIKNNPHP RSYYKCTSAR CSAKKHVEKS TDDPEMLIVT YEGSHLHGPQ  60
TT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A8e-242571974Probable WRKY transcription factor 4
1wj2_A8e-242571974Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3626861e-94AK362686.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2009G15.
GenBankDQ8631301e-94DQ863130.1 Hordeum vulgare WRKY transcription factor 36 (WRKY36) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970546.11e-33PREDICTED: uncharacterized protein LOC101763814 isoform X2
RefseqXP_004970545.12e-33PREDICTED: uncharacterized protein LOC101763814 isoform X1
SwissprotQ9C9832e-25WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLB2KJ863e-41B2KJ86_HORVU; WRKY transcription factor 36 (Fragment)
TrEMBLM0V6152e-41M0V615_HORVD; Uncharacterized protein
TrEMBLW5CBN19e-42W5CBN1_WHEAT; Uncharacterized protein
STRINGMLOC_19031.27e-40(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131442633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.21e-26WRKY DNA-binding protein 57
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]